PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr10P21480_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family MIKC_MADS
Protein Properties Length: 319aa    MW: 36829.2 Da    PI: 8.9369
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr10P21480_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF983.9e-3186136151
                             S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
                  SRF-TF   1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 
                             krien++nrqvtf+kRrng+lKKA+ELSvLCda+va+i+fss+g+lyey++
  GSMUA_Achr10P21480_001  86 KRIENTTNRQVTFCKRRNGLLKKAYELSVLCDADVALIVFSSRGRLYEYAT 136
                             79***********************************************86 PP

2K-box1111.3e-361572508100
                   K-box   8 s.leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenka 93 
                               ++e +a+++qqe++kL+++i+nLq+++R l+Ge+L+s+sl++++qLe++Lek+++kiR+kKnell+++ie++qk+e elq++n++
  GSMUA_Achr10P21480_001 157 GfASEDNAQYYQQEASKLRQQINNLQSTNRSLMGESLGSMSLRDMKQLETRLEKGINKIRNKKNELLFAEIEYMQKREMELQNDNMY 243
                             4578999******************************************************************************** PP

                   K-box  94 Lrkklee 100
                             Lr+k++e
  GSMUA_Achr10P21480_001 244 LRNKIAE 250
                             ****986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004326.6E-4378137IPR002100Transcription factor, MADS-box
PROSITE profilePS5006634.04878138IPR002100Transcription factor, MADS-box
CDDcd002651.18E-4579152No hitNo description
SuperFamilySSF554554.19E-3379152IPR002100Transcription factor, MADS-box
PROSITE patternPS00350080134IPR002100Transcription factor, MADS-box
PRINTSPR004042.6E-3280100IPR002100Transcription factor, MADS-box
PfamPF003191.1E-2687134IPR002100Transcription factor, MADS-box
PRINTSPR004042.6E-32100115IPR002100Transcription factor, MADS-box
PRINTSPR004042.6E-32115136IPR002100Transcription factor, MADS-box
PfamPF014864.5E-28161248IPR002487Transcription factor, K-box
PROSITE profilePS5129715.59164254IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048366Biological Processleaf development
GO:0048440Biological Processcarpel development
GO:0048443Biological Processstamen development
GO:0048497Biological Processmaintenance of floral organ identity
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 319 aa     Download sequence    Send to blast
MDEDFTLFEC CHDSTLIQKY FPLTIINVPL NTQERGIAEL LVTIAVPFSP QTFFFASASA  60
FLLLLLRRGA TLEPPARMGR GKIEIKRIEN TTNRQVTFCK RRNGLLKKAY ELSVLCDADV  120
ALIVFSSRGR LYEYATNSVK ATIDRYKKAC NGTTNTGFAS EDNAQYYQQE ASKLRQQINN  180
LQSTNRSLMG ESLGSMSLRD MKQLETRLEK GINKIRNKKN ELLFAEIEYM QKREMELQND  240
NMYLRNKIAE NERAQQQMSM LPSARTTEYE IMPPYDSRNF LQVNAVQPTQ HYTHQQRTAL  300
QLGTPCTRWV MCSCCHFCR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P1e-1978146169Myocyte-specific enhancer factor 2B
1tqe_Q1e-1978146169Myocyte-specific enhancer factor 2B
1tqe_R1e-1978146169Myocyte-specific enhancer factor 2B
1tqe_S1e-1978146169Myocyte-specific enhancer factor 2B
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00609ChIP-seqTransfer from AT4G18960Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009380480.11e-166PREDICTED: MADS-box transcription factor 3-like isoform X2
SwissprotQ408721e-120AG_PANGI; Floral homeotic protein AGAMOUS
TrEMBLM0RK730.0M0RK73_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr10P21480_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP64937144
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18960.18e-99MIKC_MADS family protein